PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009150854.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 871aa    MW: 95947.5 Da    PI: 4.89
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009150854.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.13.5e-28598648252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek i le+l++yF++++kdAAk++gvc+T+LKriCR++GI RWP+Rkik++
  XP_009150854.1 598 EKIIGLEVLQQYFAGSLKDAAKSIGVCPTTLKRICRHHGITRWPSRKIKKV 648
                     7889*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.450.408.8E-4190284IPR029016GAF domain-like
PROSITE profilePS5151916.642587668IPR003035RWP-RK domain
PfamPF020422.4E-24601648IPR003035RWP-RK domain
SuperFamilySSF542771.28E-23763858No hitNo description
Gene3DG3DSA:3.10.20.2401.1E-23771854No hitNo description
SMARTSM006666.8E-28773856IPR000270PB1 domain
PROSITE profilePS5174526.993773856IPR000270PB1 domain
CDDcd064074.88E-42774855No hitNo description
PfamPF005644.8E-16774855IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 871 aa     Download sequence    Send to blast
MEEDGGSDGG EGNGGFSPNS SFGAFPEMPM DLDLDELFFD GCWLETTDLK QSEETASASN  60
AVNDNTPFLY FSENSFQENV SNEETERTPN QEPLNQVASS SEQAEKFLLE EAEVARRWWI  120
APRGSEGPSS SVKERLLRAI SGLDEAVPDK DFLVQIWVPF QQEGKNFLTT LAQPHLFNQK  180
YSSLAKYRHV SETYNFPADE GSKDVGLPGR VFLQKLPEWT PDVRFFRSEE YPRIKEAQKC  240
DVRGSLAVPV FERGSGTCLG VVEIITTTQK MNYRPELENI CKALEAVDLR SSSNLKTPST  300
EFLQVYNDFY YAALPEISDF LASVCRSYDL PLALSWAPCD RQGKGGSRHS DENFSQCVST  360
IDSACFVLDD QSKCFLEACS EYHLLQGEGM VGKAFKETKL FFVPEVTIFS KTNYALAHHA  420
KVSGLHAALA VPLKGKSNGL VEFVLEFFFP KSCIDTEAKE KMLKSLSVTL QQDFRSSNLV  480
IDKDLELEVV LPDGEDMVLS ESPLNGAETE ESLREVHMQD SSQMIKANEK GKDKKDESKL  540
SSGMDNSQLD SVPNNVPSGA EPGGLRVDAG PSTEPASTGG GSMLGSRRPG DKRRSKNEKI  600
IGLEVLQQYF AGSLKDAAKS IGVCPTTLKR ICRHHGITRW PSRKIKKVGH SLKKLQVVMD  660
SVQGAQGSLP LDSFYSSFPA LSSPNMSSNG PSLKNKEQIQ HLAEDKPAPR SPSSSCSGSS  720
TNTANTLQVA EEADAVLKKA HSEAELHKTF KEPPLLENLA GSSSNKSLRA GGGIKVKATF  780
GEAIIRFTLP PSWGYRELEQ EIARRFSIDD VSWFDLKYLD DDKEWVLLKC EGDLEECIDI  840
HRSSQSQTIK ISLHDAFQVK LGGSFGSTGA S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009150854.10.0PREDICTED: protein NLP1-like
RefseqXP_009150853.10.0PREDICTED: protein NLP1-like
RefseqXP_009150852.10.0PREDICTED: protein NLP1-like
SwissprotQ8H1110.0NLP1_ARATH; Protein NLP1
TrEMBLM4CZL20.0M4CZL2_BRARP; Uncharacterized protein
STRINGBra009659.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17150.10.0Nin-like family protein